Reference match
LL-37 resolves to a cathelicidin library hit with exact sequence coverage.
We’re entering a new era of peptide discovery — where frontier AI can turn deeper molecular insight into faster candidate decisions, bringing autonomous lab intelligence closer to new treatments that matter.
Driven by autonomous agents, every submitted sequence becomes an analyzed, scored, and receipt-backed candidate in a growing peptide intelligence network. Brought on-chain through verifiable research receipts — open database can be used by researchers worldwide for novel drug discovery and treatment candidates. Each Solana Memo acts as a timestamped contribution claim — an open trail researchers can credit, inspect, and build on.
Submit peptide ideas, generate receipt-backed candidate records. If a researcher later explores that candidate, cites it, publishes around it, or builds IP from it, they can credit the original contributor.
More trusted contributors, better data. $PepOS expands launch-phase run capacity while base submissions and browsing stay open. Reward and credit mechanics come later as receipts build the contribution graph.
Every analyzed candidate expands PepAgent’s signal map with more examples, edge cases, motif patterns, and scoring outcomes.
Why it matters
PepAgent turns a raw sequence or peptide name into a structured triage record: what it resembles, which biochemical signals look strong, which weak signals should be dropped, and what should be handed off for deeper research.
The point is credible early-stage narrowing: score the signal, expose the caveats, preserve the record, and move only the best candidates toward deeper modeling, synthesis planning, or wet-lab review.
LL-37 resolves to a cathelicidin library hit with exact sequence coverage.
Charge, hydrophobicity, motif, and amphipathicity signals are split into explainable evidence lanes.
Risk and follow-up signals are surfaced before a candidate enters the research queue.
The run becomes a receipt-backed candidate card with a wallet-signable Solana Memo payload.
PepAgent designs, analyzes, scores, and logs candidate peptide ideas through a seven-stage AI workflow — then anchors the result as a SHA-256 receipt on Solana.
PepAgent designs, analyzes, and scores peptide ideas through transparent biochemical gates, reference matching, motif signals, and receipt-backed run records.
Cross-referenced sequences spanning antimicrobials, cathelicidins, defensins, cell-penetrating peptides, neuropeptides, hormones, and cyclic research candidates. Family assignments, motif patterns, and characterisation status logged per entry.
Each run produces a SHA-256 receipt hash and a UTF-8 Memo payload. Connected wallets can anchor receipts to Solana mainnet via the Memo Program — no custody, explicit approval.
Gates, flags, and copy are scoped to research informatics. No diagnosis, therapeutic, or clinical validation claims. Flags surface when candidates fall outside characterised territory.
Analysis engine
Seven-stage specialised AI peptide workflow — scored, logged, and receipt-anchored.
Intake peptide name, sequence, or candidate direction — prepare a PepAgent run context.
Accepts common names, reference identifiers, or raw IUPAC sequences
Classify input, resolve aliases and reference names, separate sequence vs candidate intent.
Resolves cathelicidin, defensin, neuropeptide names to canonical sequence form
Clean residues, validate amino-acid alphabet, compute length and composition baseline.
20 standard amino-acid gate; short · medium · long band classification
Compare against known peptide reference signals, motifs, families, and sequence similarity.
Antimicrobials · cathelicidins · defensins · CPPs · neuropeptides · cyclic peptides
Run biochemical gates: charge, hydrophobicity, amphipathicity, cysteine bridge potential, novelty.
Specialised AI PepAgent triage with transparent biochemical gates
Surface cationic, hydrophobic, cysteine, proline, and novelty signals with research-boundary cautions.
10 flag types; candidates outside characterized territory are explicitly marked
Compile canonical run fields into SHA-256 receipt hash and Memo-ready lab payload.
Identical inputs always produce identical hashes; anchor via Memo Program, explicit approval
Bee-venom amphipathic AMP; classic membrane-disruption model.
Frog-skin toroidal-pore AMP; amphipathic alpha-helix scaffold.
Only known human cathelicidin AMP; cationic and immunomodulatory.
First reported CPP; from Antennapedia homeodomain helix 3.
Example runs showing how PepAgent parses, matches, and flags different input types.
LL-37Name resolved → sequence. Cationic flag expected for human cathelicidin AMP.
GIGAVLKVLTTGLPALISWIKRKRQQRaw sequence matched Melittin exactly. Amphipathic α-helix pattern confirmed.
ACYCRIPACIAGERRYGTCIYQGRLWAFCCHNP-1 defensin. Odd cysteine flag from triple disulfide accounting edge.